• Home
  • popular
  • Events
  • Submit New Event
  • Subscribe
  • About
  • News
  • Restaurants + Bars
  • City Life
  • Entertainment
  • Travel
  • Real Estate
  • Arts
  • Society
  • Home + Design
  • Fashion + Beauty
  • Innovation
  • Sports
  • Charity Guide
  • children
  • education
  • health
  • veterans
  • SOCIAL SERVICES
  • ARTS + CULTURE
  • animals
  • lgbtq
  • New Charity
  • Series
  • Delivery Limited
  • DTX Giveaway 2012
  • DTX Ski Magic
  • dtx woodford reserve manhattans
  • Your Home in the Sky
  • DTX Best of 2013
  • DTX Trailblazers
  • Tastemakers Dallas 2017
  • Healthy Perspectives
  • Neighborhood Eats 2015
  • The Art of Making Whiskey
  • DTX International Film Festival
  • DTX Tatum Brown
  • Tastemaker Awards 2016 Dallas
  • DTX McCurley 2014
  • DTX Cars in Lifestyle
  • DTX Beyond presents Party Perfect
  • DTX Texas Health Resources
  • DART 2018
  • Alexan Central
  • State Fair 2018
  • Formula 1 Giveaway
  • Zatar
  • CityLine
  • Vision Veritas
  • Okay to Say
  • Hearts on the Trinity
  • DFW Auto Show 2015
  • Northpark 50
  • Anteks Curated
  • Red Bull Cliff Diving
  • Maggie Louise Confections Dallas
  • Gaia
  • Red Bull Global Rally Cross
  • NorthPark Holiday 2015
  • Ethan's View Dallas
  • DTX City Centre 2013
  • Galleria Dallas
  • Briggs Freeman Sotheby's International Realty Luxury Homes in Dallas Texas
  • DTX Island Time
  • Simpson Property Group SkyHouse
  • DIFFA
  • Lotus Shop
  • Holiday Pop Up Shop Dallas
  • Clothes Circuit
  • DTX Tastemakers 2014
  • Elite Dental
  • Elan City Lights
  • Dallas Charity Guide
  • DTX Music Scene 2013
  • One Arts Party at the Plaza
  • J.R. Ewing
  • AMLI Design District Vibrant Living
  • Crest at Oak Park
  • Braun Enterprises Dallas
  • NorthPark 2016
  • Victory Park
  • DTX Common Desk
  • DTX Osborne Advisors
  • DTX Comforts of Home 2012
  • DFW Showcase Tour of Homes
  • DTX Neighborhood Eats
  • DTX Comforts of Home 2013
  • DTX Auto Awards
  • Cottonwood Art Festival 2017
  • Nasher Store
  • Guardian of The Glenlivet
  • Zyn22
  • Dallas Rx
  • Yellow Rose Gala
  • Opendoor
  • DTX Sun and Ski
  • Crow Collection
  • DTX Tastes of the Season
  • Skye of Turtle Creek Dallas
  • Cottonwood Art Festival
  • DTX Charity Challenge
  • DTX Culture Motive
  • DTX Good Eats 2012
  • DTX_15Winks
  • St. Bernard Sports
  • Jose
  • DTX SMU 2014
  • DTX Up to Speed
  • st bernard
  • Ardan West Village
  • DTX New York Fashion Week spring 2016
  • Taste the Difference
  • Parktoberfest 2016
  • Bob's Steak and Chop House
  • DTX Smart Luxury
  • DTX Earth Day
  • DTX_Gaylord_Promoted_Series
  • IIDA Lavish
  • Huffhines Art Trails 2017
  • Red Bull Flying Bach Dallas
  • Y+A Real Estate
  • Beauty Basics
  • DTX Pet of the Week
  • Long Cove
  • Charity Challenge 2014
  • Legacy West
  • Wildflower
  • Stillwater Capital
  • Tulum
  • DTX Texas Traveler
  • Dallas DART
  • Soldiers' Angels
  • Alexan Riveredge
  • Ebby Halliday Realtors
  • Zephyr Gin
  • Sixty Five Hundred Scene
  • Christy Berry
  • Entertainment Destination
  • Dallas Art Fair 2015
  • St. Bernard Sports Duck Head
  • Jameson DTX
  • Alara Uptown Dallas
  • Cottonwood Art Festival fall 2017
  • DTX Tastemakers 2015
  • Cottonwood Arts Festival
  • The Taylor
  • Decks in the Park
  • Alexan Henderson
  • Gallery at Turtle Creek
  • Omni Hotel DTX
  • Red on the Runway
  • Whole Foods Dallas 2018
  • Artizone Essential Eats
  • Galleria Dallas Runway Revue
  • State Fair 2016 Promoted
  • Trigger's Toys Ultimate Cocktail Experience
  • Dean's Texas Cuisine
  • Real Weddings Dallas
  • Real Housewives of Dallas
  • Jan Barboglio
  • Wildflower Arts and Music Festival
  • Hearts for Hounds
  • Okay to Say Dallas
  • Indochino Dallas
  • Old Forester Dallas
  • Dallas Apartment Locators
  • Dallas Summer Musicals
  • PSW Real Estate Dallas
  • Paintzen
  • DTX Dave Perry-Miller
  • DTX Reliant
  • Get in the Spirit
  • Bachendorf's
  • Holiday Wonder
  • Village on the Parkway
  • City Lifestyle
  • opportunity knox villa-o restaurant
  • Nasher Summer Sale
  • Simpson Property Group
  • Holiday Gift Guide 2017 Dallas
  • Carlisle & Vine
  • DTX New Beginnings
  • Get in the Game
  • Red Bull Air Race
  • Dallas DanceFest
  • 2015 Dallas Stylemaker
  • Youth With Faces
  • Energy Ogre
  • DTX Renewable You
  • Galleria Dallas Decadence
  • Bella MD
  • Tractorbeam
  • Young Texans Against Cancer
  • Fresh Start Dallas
  • Dallas Farmers Market
  • Soldier's Angels Dallas
  • Shipt
  • Elite Dental
  • Texas Restaurant Association 2017
  • State Fair 2017
  • Scottish Rite
  • Brooklyn Brewery
  • DTX_Stylemakers
  • Alexan Crossings
  • Ascent Victory Park
  • Top Texans Under 30 Dallas
  • Discover Downtown Dallas
  • San Luis Resort Dallas
  • Greystar The Collection
  • FIG Finale
  • Greystar M Line Tower
  • Lincoln Motor Company
  • The Shelby
  • Jonathan Goldwater Events
  • Windrose Tower
  • Gift Guide 2016
  • State Fair of Texas 2016
  • Choctaw Dallas
  • TodayTix Dallas promoted
  • Whole Foods
  • Unbranded 2014
  • Frisco Square
  • Unbranded 2016
  • Circuit of the Americas 2018
  • The Katy
  • Snap Kitchen
  • Partners Card
  • Omni Hotels Dallas
  • Landmark on Lovers
  • Harwood Herd
  • Galveston.com Dallas
  • Holiday Happenings Dallas 2018
  • TenantBase
  • Cottonwood Art Festival 2018
  • Hawkins-Welwood Homes
  • The Inner Circle Dallas
  • Eating in Season Dallas
  • ATTPAC Behind the Curtain
  • TodayTix Dallas
  • The Alexan
  • Toyota Music Factory
  • Nosh Box Eatery
  • Wildflower 2018
  • Society Style Dallas 2018
  • Texas Scottish Rite Hospital 2018
  • 5 Mockingbird
  • 4110 Fairmount
  • Visit Taos
  • Allegro Addison
  • Dallas Tastemakers 2018
  • The Village apartments
  • City of Burleson Dallas

    Explosive Moviemaking

    Visually stunning Mad Max: Fury Road may be the most memorable movie of 2015

    Alex Bentley
    May 15, 2015 | 12:00 am
    Visually stunning Mad Max: Fury Road may be the most memorable movie of 2015
    play icon

    In Hollywood, especially in recent years, everything old is new again, with properties and franchises being revived years or even decades after they were last seen. Usually people who had little or nothing to do with the original films take on the new projects, but Mad Max: Fury Road was done by the same writer/director who brought the franchise to life in 1979, George Miller.

    Miller’s involvement is just the first of the positive signs for the new film. The second, as anyone who’s seen the film’s trailers can attest, is the approach Miller and his team took toward the stunts in the film. Instead of relying on CGI to do the heavy lifting, they took the old-fashioned approach of putting actors and stunt men and women in harm’s way for the film’s absolutely bonkers car chase scenes.

    It all adds up to what’s sure to be one of the most memorable movies of 2015, whether it’s considered to be one of the best or not. Set in a post-apocalyptic wasteland where a warlord, Immortan Joe (Hugh Keays-Byrne), rules over a population desperate for water and gas, the film is a visual stunner virtually from beginning to end.

    It doesn’t really matter all that much if you have limited knowledge of the first three Mad Max films, the last of which was 30 years ago. All you really need to know is that Max Rockatansky (Tom Hardy, taking over the Mel Gibson role) is still a loner who speaks very little, and this time around he finds himself helping Furiosa (Charlize Theron), who has betrayed Immortan Joe and is on the run from him and his minions.

    Despite what you may hope or believe from the trailers, the film is not non-stop action, a fact that might be a disappointment for some. However, instead of using the film’s quieter moments to flesh out the background of key characters, Miller seems to prefer to let the visuals doing the talking, filling the screen with all manner of oddities.

    The lack of a complete story doesn’t really hold the film back, but it does make it less than it could have been. Still, when the rest of the movie is as inventive as it is, actual exposition can prove unnecessary. The details on everything from the costumes to the cars to the weapons are a sight to behold, each of them telling their own mini-story within the larger picture.

    The car chases – or, more accurately, the car crashes – are as over-the-top as advertised. Although there are times where CGI obviously comes into play, for the most part it’s plain to see that the stunts were done with practical effects and real people. The thrill factor is upped exponentially because of this decision, with one sequence, in which people high atop poles drop down on other vehicles, taking the cake.

    But it’s not just the stunts that are eye-popping. The cinematography by Oscar winner John Seale is for the ages, and is one of the few instances in which the use of 3D proves to be a real boon to the final product. Seale uses varying colors, wide angles and more to take in the full scope of the film’s desert setting, and there are times when your jaw will drop at how beautiful he makes it seem.

    Hardy is already well known for being a taciturn actor, which means that the role of Max fits him to a tee. Using few words and a mysterious yet alluring accent, Hardy makes Max into someone to be feared or trusted, depending on which side you’re on. Theron is the co-lead, and she grabs the opportunity for all it’s worth. She lives up to her character’s name in every way while still ensuring that Furiosa’s femininity never gets lost.

    Special note should also be made of Nicholas Hoult, who plays Lux, one of Immortan Joe’s zombie-esque minions. Not only does he get the line – “Oh, what a day! What a lovely day!” – that is already the movie quote of the summer, but he plays his role in such a creepy yet innocent way that he threatens to steal every scene he’s in.

    While Hollywood is rightly taken to task for remaking too many old movies instead of coming up with new ideas, Mad Max: Fury Road proves that there’s always an exception to every rule. Any movie fan worth his or her salt will walk away with glee from this visceral delight.

    Tom Hardy in Mad Max: Fury Road.

    Tom Hardy in Mad Max: Fury Road
    Photo by Jasin Boland Warner Bros. Pictures
    Tom Hardy in Mad Max: Fury Road.
    unspecified
    news/entertainment

    Weekend Event Planner

    These are the 15 best things to do in Dallas this weekend

    Alex Bentley
    Mar 12, 2026 | 6:00 am
    Greenville Avenue St. Patrick's Day Parade in Dallas
    Photo by Jerry McClure
    St. Patrick's Day in Dallas is always a spirited affair.

    Mid-March brings a slew of great things to do in and around Dallas, including one of the biggest one-day events on the calendar: the annual St. Patrick's Day Parade. Other choices include a dance production, five theater productions, a huge car race, the opening of new art exhibition, a new circus, a trio of concerts, a well-known comedian, and a classic story told on ice.

    Below are the best ways to spend your free time this weekend. If you want more options, check out our calendar for an even longer list of the city's best events.

    Thursday, March 12

    World Ballet Company presents Swan Lake
    The legendary tale of Swan Lake takes flight in a production from World Ballet Company, as fate and magic entwine in a timeless battle between good and evil. Performing with a live orchestra and featuring a cast of 50 international dancers, over 150 hand-sewn costumes, and hand-crafted sets, the ballet captures every moment — from the Dance of the Little Swans to the Black Swan’s 32 fouettés and every pirouette in between. The performance takes place at Majestic Theatre.

    The Firehouse Theatre presents The Producers
    In The Producers, a down-on-his-luck Broadway producer and his mild-mannered accountant come up with a scheme to produce the most notorious flop in history, thereby bilking their backers (all "little old ladies") out of millions of dollars. Only one thing goes awry: the show is a smash hit. The production runs through March 29 at The Firehouse Theatre in Farmers Branch.

    Broadway Dallas presents A Beautiful Noise: The Neil Diamond Musical
    A Beautiful Noise is the untold true story of a Brooklyn kid who became a chart-busting, show-stopping, award-winning American icon, created in collaboration with Neil Diamond himself. Diamond's story is an energy-filled musical memoir that tells the story of how America's greatest hitmaker became a star, set to the songs that defined his career. The production runs through March 22 at the Music Hall at Fair Park.

    Rover Dramawerks presents All's Fair in Love and Theatre
    Up-and-coming director Leah Harris is bearing the brunt of attacks in the prestigious Theatre Outstanding Competition, but she’s still determined to fight fair. Plus, she’s dealing with feuding stars, divorcing crew members, and a team liaison who barely knows his stage right from his stage left. It’s going to be the longest, and shortest, weekend of her life. The production runs through March 28 at Cox Playhouse in Plano.

    Broadway at the Center presents The Music Man
    Meredith Willson’s six-time Tony Award-winning musical comedy The Music Man follows fast-talking traveling salesman Harold Hill as he cons the people of River City, Iowa, into buying instruments and uniforms for a boys’ band that he vows to organize — this, despite the fact that he doesn’t know a trombone from a treble clef. The production will have four performances through Sunday at Winspear Opera House.

    Friday, March 13

    Java House Grand Prix of Arlington
    The Java House Grand Prix of Arlington will feature a 2.73-mile track layout that will weave through Arlington’s sports and entertainment district, which includes both AT&T Stadium and Globe Life Field, as well as Choctaw Stadium, the Arlington Convention Center, and more. There will be practice and qualifying sessions on Friday and Saturday before the main event on Sunday. All Time Low, T-Pain, Giovannie and the Hired Guns, and Disco Lines will provide musical entertainment on different days.

    Dallas Holocaust and Human Rights Museum presents "The Walt Disney Studios and World War II Exhibition" opening day
    "The Walt Disney Studios and World War II" is an immersive, family-friendly exhibition that illustrates how The Walt Disney Studios contributed to the Allies' war effort by devoting over 90 percent of its output to producing original artwork, as well as training and public-service films. The exhibition, which includes more than 500 examples of rare, historical objects and film clips, will remain on display at Dallas Holocaust and Human Rights Museum through September 10.

    Flip Circus
    Flip Circus is a brand-new big top entertainment experience created by the Vazquez family of Circus Vazquez fame. It features performers from around the world, including illusionist Jimmy Saylon, comedian Misha, juggler Dede Larible, trapeze artist Alexander Lichner, martial artists The Kung Fu Boys, and more. The circus will be in a big top tent in the parking lot at Riders Field in Frisco through March 30.

    Il Divo in concert
    Vocal group Il Divo comes to Dallas with their Il Divo By Candlelight tour, taking fans on a journey through two decades of romance, heartache, and joy. They have released 11 albums in their career, most recently XX in 2024. At this concert at Majestic Theater, Il Divo will be joined by Phoenix-based string trio Simply Three.

    Verdigris Ensemble presents A Western & To The West
    Verdigris Ensemble will present A Western & To The West, an immersive, genre-defying choral performance that reimagines the mythology of the American West. Inspired by the iconic film High Noon, the semi-staged production places the audience inside a fractured frontier where voices function as both narrator and environment. Through voice, movement, and cinematic projection, the choir becomes character, landscape, and emotional force, confronting themes of courage, community, and moral reckoning. There will be three performances through Sunday in Hamon Hall at Winspear Opera House.

    Garland Civic Theatre presents Rumors
    Chris and Ken Gorman arrive at a fancy dinner party for their friend, Charley Brock. They discover that all is not well, and that Charley has had an accident involving a shotgun and his earlobe. This could be damaging to Charley’s reputation, as he is deputy mayor of New York City. As Chris and Ken’s friends begin to arrive and they attempt to cover up the facts, hilarity ensues. The production runs through March 29 at Granville Arts Center in Garland.

    Dallas Symphony Orchestra presents "Danny Elfman’s Music from the Films of Tim Burton"
    "Danny Elfman’s Music from the Films of Tim Burton" is a unique concert experience that lends music and visuals to celebrate the 25-year partnership of two of Hollywood’s top creators. The live concert features Elfman’s famous Burton film scores brought to life on stage by orchestra, enhanced by visuals on the big screen of original sketches, drawings and storyboards. The concert will feature Elfman in person as a special guest, violinist Sandy Cameron, and the Dallas Symphony Chorus. There will be three performances through Sunday at Meyerson Symphony Center.

    Improv Arlington presents Shawn Wayans
    Shawn Wayans is the second youngest brother in the famous Wayans family, getting his start in the late 1980s in the movie I'm Gonna Get You Sucka and as part of the cast of the comedy series, In Living Color. This summer, he and his brother Marlon are returning to the Scary Movie franchise for the first time in 25 years. He'll perform four times through Saturday at Improv Arlington.

    Saturday, March 14

    Dallas St. Patrick's Day Parade & Festival
    The annual Dallas St. Patrick’s Parade & Festival is the largest St. Patrick’s Parade in the Southwest. Starting at Greenville Avenue and Blackwell Street and ending at SMU Blvd. and Central Expressway, the parade draws upwards of 125,000 people along the two-mile route to see more than 90 floats, 1,700 participants, bands, and more. Revelers can head a little further down the road to the Lower Greenville St. Patrick’s Day Block Party for a day full of great music, beer, and plenty of St. Patrick’s Day cheer at bars like Stan’s Blue Note, The Dubliner, Terilli’s Restaurant, Halcyon, Christie’s Sports Bar, Sister Restaurant, and Goodwins.

    Sunday, March 15

    Coppell Arts Center presents Wizard of Oz on Ice
    World-renowned professional skating champions will bring the beloved tale of The Wizard of Oz to life on ice, combining breathtaking performances with interactive elements for audiences of all ages. It features all the classic moments, including Dorothy’s iconic journey down the Yellow Brick Road and the magical encounters with the Scarecrow, Tin Man, and Cowardly Lion. There will be two performances on Sunday at Coppell Arts Center in Coppell.

    Greenville Avenue St. Patrick's Day Parade in Dallas
    Photo by Jerry McClure
    St. Patrick's Day in Dallas is always a spirited affair.
    dancetheatermusicracesexhibitions-visual-artsconcertssymphonycomedyfestivalsholidayskidsfamiliesevent-planner
    news/entertainment
    Loading...