• Home
  • popular
  • Events
  • Submit New Event
  • Subscribe
  • About
  • News
  • Restaurants + Bars
  • City Life
  • Entertainment
  • Travel
  • Real Estate
  • Arts
  • Society
  • Home + Design
  • Fashion + Beauty
  • Innovation
  • Sports
  • Charity Guide
  • children
  • education
  • health
  • veterans
  • SOCIAL SERVICES
  • ARTS + CULTURE
  • animals
  • lgbtq
  • New Charity
  • Series
  • Delivery Limited
  • DTX Giveaway 2012
  • DTX Ski Magic
  • dtx woodford reserve manhattans
  • Your Home in the Sky
  • DTX Best of 2013
  • DTX Trailblazers
  • Tastemakers Dallas 2017
  • Healthy Perspectives
  • Neighborhood Eats 2015
  • The Art of Making Whiskey
  • DTX International Film Festival
  • DTX Tatum Brown
  • Tastemaker Awards 2016 Dallas
  • DTX McCurley 2014
  • DTX Cars in Lifestyle
  • DTX Beyond presents Party Perfect
  • DTX Texas Health Resources
  • DART 2018
  • Alexan Central
  • State Fair 2018
  • Formula 1 Giveaway
  • Zatar
  • CityLine
  • Vision Veritas
  • Okay to Say
  • Hearts on the Trinity
  • DFW Auto Show 2015
  • Northpark 50
  • Anteks Curated
  • Red Bull Cliff Diving
  • Maggie Louise Confections Dallas
  • Gaia
  • Red Bull Global Rally Cross
  • NorthPark Holiday 2015
  • Ethan's View Dallas
  • DTX City Centre 2013
  • Galleria Dallas
  • Briggs Freeman Sotheby's International Realty Luxury Homes in Dallas Texas
  • DTX Island Time
  • Simpson Property Group SkyHouse
  • DIFFA
  • Lotus Shop
  • Holiday Pop Up Shop Dallas
  • Clothes Circuit
  • DTX Tastemakers 2014
  • Elite Dental
  • Elan City Lights
  • Dallas Charity Guide
  • DTX Music Scene 2013
  • One Arts Party at the Plaza
  • J.R. Ewing
  • AMLI Design District Vibrant Living
  • Crest at Oak Park
  • Braun Enterprises Dallas
  • NorthPark 2016
  • Victory Park
  • DTX Common Desk
  • DTX Osborne Advisors
  • DTX Comforts of Home 2012
  • DFW Showcase Tour of Homes
  • DTX Neighborhood Eats
  • DTX Comforts of Home 2013
  • DTX Auto Awards
  • Cottonwood Art Festival 2017
  • Nasher Store
  • Guardian of The Glenlivet
  • Zyn22
  • Dallas Rx
  • Yellow Rose Gala
  • Opendoor
  • DTX Sun and Ski
  • Crow Collection
  • DTX Tastes of the Season
  • Skye of Turtle Creek Dallas
  • Cottonwood Art Festival
  • DTX Charity Challenge
  • DTX Culture Motive
  • DTX Good Eats 2012
  • DTX_15Winks
  • St. Bernard Sports
  • Jose
  • DTX SMU 2014
  • DTX Up to Speed
  • st bernard
  • Ardan West Village
  • DTX New York Fashion Week spring 2016
  • Taste the Difference
  • Parktoberfest 2016
  • Bob's Steak and Chop House
  • DTX Smart Luxury
  • DTX Earth Day
  • DTX_Gaylord_Promoted_Series
  • IIDA Lavish
  • Huffhines Art Trails 2017
  • Red Bull Flying Bach Dallas
  • Y+A Real Estate
  • Beauty Basics
  • DTX Pet of the Week
  • Long Cove
  • Charity Challenge 2014
  • Legacy West
  • Wildflower
  • Stillwater Capital
  • Tulum
  • DTX Texas Traveler
  • Dallas DART
  • Soldiers' Angels
  • Alexan Riveredge
  • Ebby Halliday Realtors
  • Zephyr Gin
  • Sixty Five Hundred Scene
  • Christy Berry
  • Entertainment Destination
  • Dallas Art Fair 2015
  • St. Bernard Sports Duck Head
  • Jameson DTX
  • Alara Uptown Dallas
  • Cottonwood Art Festival fall 2017
  • DTX Tastemakers 2015
  • Cottonwood Arts Festival
  • The Taylor
  • Decks in the Park
  • Alexan Henderson
  • Gallery at Turtle Creek
  • Omni Hotel DTX
  • Red on the Runway
  • Whole Foods Dallas 2018
  • Artizone Essential Eats
  • Galleria Dallas Runway Revue
  • State Fair 2016 Promoted
  • Trigger's Toys Ultimate Cocktail Experience
  • Dean's Texas Cuisine
  • Real Weddings Dallas
  • Real Housewives of Dallas
  • Jan Barboglio
  • Wildflower Arts and Music Festival
  • Hearts for Hounds
  • Okay to Say Dallas
  • Indochino Dallas
  • Old Forester Dallas
  • Dallas Apartment Locators
  • Dallas Summer Musicals
  • PSW Real Estate Dallas
  • Paintzen
  • DTX Dave Perry-Miller
  • DTX Reliant
  • Get in the Spirit
  • Bachendorf's
  • Holiday Wonder
  • Village on the Parkway
  • City Lifestyle
  • opportunity knox villa-o restaurant
  • Nasher Summer Sale
  • Simpson Property Group
  • Holiday Gift Guide 2017 Dallas
  • Carlisle & Vine
  • DTX New Beginnings
  • Get in the Game
  • Red Bull Air Race
  • Dallas DanceFest
  • 2015 Dallas Stylemaker
  • Youth With Faces
  • Energy Ogre
  • DTX Renewable You
  • Galleria Dallas Decadence
  • Bella MD
  • Tractorbeam
  • Young Texans Against Cancer
  • Fresh Start Dallas
  • Dallas Farmers Market
  • Soldier's Angels Dallas
  • Shipt
  • Elite Dental
  • Texas Restaurant Association 2017
  • State Fair 2017
  • Scottish Rite
  • Brooklyn Brewery
  • DTX_Stylemakers
  • Alexan Crossings
  • Ascent Victory Park
  • Top Texans Under 30 Dallas
  • Discover Downtown Dallas
  • San Luis Resort Dallas
  • Greystar The Collection
  • FIG Finale
  • Greystar M Line Tower
  • Lincoln Motor Company
  • The Shelby
  • Jonathan Goldwater Events
  • Windrose Tower
  • Gift Guide 2016
  • State Fair of Texas 2016
  • Choctaw Dallas
  • TodayTix Dallas promoted
  • Whole Foods
  • Unbranded 2014
  • Frisco Square
  • Unbranded 2016
  • Circuit of the Americas 2018
  • The Katy
  • Snap Kitchen
  • Partners Card
  • Omni Hotels Dallas
  • Landmark on Lovers
  • Harwood Herd
  • Galveston.com Dallas
  • Holiday Happenings Dallas 2018
  • TenantBase
  • Cottonwood Art Festival 2018
  • Hawkins-Welwood Homes
  • The Inner Circle Dallas
  • Eating in Season Dallas
  • ATTPAC Behind the Curtain
  • TodayTix Dallas
  • The Alexan
  • Toyota Music Factory
  • Nosh Box Eatery
  • Wildflower 2018
  • Society Style Dallas 2018
  • Texas Scottish Rite Hospital 2018
  • 5 Mockingbird
  • 4110 Fairmount
  • Visit Taos
  • Allegro Addison
  • Dallas Tastemakers 2018
  • The Village apartments
  • City of Burleson Dallas

    Farmers Market News

    Mega-facility with futsal and boozy pops opens at Dallas Farmers Market

    Micah Moore
    Jul 19, 2019 | 4:25 pm
    City Futsal
    New facility is right in the middle of the Dallas Farmerks Market.
    Photo courtesy of City Futsal

    A new sports and social destination has opened at Dallas Farmers Market, breathing new life into an abandoned tunnel and parking lot.

    Called City Futsal, it's a family-owned facility that specializes in futsal, a game similar to soccer and whose popularity is rapidly growing around the world.

    The club opened in June in a former parking lot at 1224 S. Cesar Chavez Blvd. and is one of the final properties to be redeveloped in the Farmers Market neighborhood by Brian Bergersen of Spectrum Properties.

    Four brothers are behind the enterprise: Manuel, Esteban, Felipe, and Federico Mariel, who grew up playing futsal in Brazil.

    They started their company in 2011, giving futsal lessons in public parks, before founding four facilities with indoor courts focused primarily on student athletes in suburbs such as Richardson and Carrollton.

    The one at the farmers market is their first to be centered on activities for adults: It features an outdoor turf field, sand volleyball, and bar.

    "This is the ultimate adult playground right on the edge of downtown," Esteban says. "It is a true family effort introducing North Texas to this fun, competitive sport."

    Popular in South America and Europe, futsal is played like soccer, five-on-five on a hard court that's smaller than a traditional soccer field.

    City Futsal offers professional-grade fields for futsal, soccer, and sand volleyball, including an indoor/outdoor futsal surface with a hard-top court laid outdoors beneath a pavilion. "No one has done anything like this anywhere," Esteban says.

    The complex also has a plush turf field measuring 180 feet by 70 feet for futsal and informal matches.

    There are three full-size sand volleyball courts, stocked with extra fluffy sand. "It's easier to dive and fall in," Esteban says.

    Each surface has its own sound system to give a different vibe to each activity, from intense futsal matches to a chill beach volleyball game.

    In the center: a cantina selling beer, wine, and boozy popsicles, as well as protein bars and other grab-and-go snacks. Anyone can come and have a drink, and they offer outdoor seating and picnic tables with games like corn hole and giant Jenga, plus big-screen TVs for watch parties.

    You can rent the court or field for $85 an hour during off times, and $110 an hour during prime weeknights and weekends, with discount rates if you join their membership program. They host tournaments, company events, and private parties. There are leagues and also pickup games.

    But if you have a membership, you can use one of the sand courts for free whenever they're open, as long as it is not being rented out for an event. And if you don't have a membership, guest passes are available at the concession for $5.

    farmer-diaries
    news/entertainment

    Winter Wonderland

    Grapevine's Gaylord Texan summons Harry Potter for magical Ice! in 2026

    Alex Bentley
    Jul 23, 2026 | 2:42 pm
    Rendering of Ice! featuring Harry Potter™ at Gaylord Texan in Grapevine
    Image courtesy of Gaylord Texan
    undefined

    The annual Ice! holiday attraction at Gaylord Texan in Grapevine will take a trip to the wizarding world when it debuts Harry Potter as the theme for its 2026 edition.

    Set to run November 13-January 3, Ice! featuring Harry Potter will greet visitors with a towering ice sculpture of Hedwig, Harry’s beloved owl, before sending them through 10 rooms filled with photo-worthy moments and iconic scenes inspired by the films, says a release.

    Themed rooms will include Hogsmeade Station, the Forbidden Forest, The Three Broomsticks, The Great Hall, and Hogwarts Castle.

    In the castle room, visitors can race down six two-story ice slides that lead toward the Quidditch Pitch, where the room will burst into light and color in celebration of each Hogwarts house, organizers say.

    As always, visitors will be provided with blue parkas to stay comfortable while the attraction is kept at a temperature of 9 degrees.

    Guests can also experience live carving demonstrations and shop for festive gifts and exclusive collectibles in the Christmas Village retail store.

    In addition to the Harry Potter-themed ice attraction, the entire resort will transform into a holiday haven, featuring 2 million twinkling lights, a 54-foot Christmas tree centerpiece, thousands of ornaments, miniature trains, and 25-foot-tall toy soldiers.

    Guests can also enjoy ice tubing, ice skating, snowball throwing, gingerbread decorating, photos with Santa, stories with Mrs. Claus, illusionist shows, character breakfasts, and more.

    2026 marks the 25th anniversary of Ice!, which was created by Gaylord Hotels in 2001 for its Nashville location; it debuted in Grapevine in 2005. The ice carvers will travel more than 6,400 miles from Harbin, China, known as the “Ice City” and home to the world’s largest ice and snow festival, to bring their art to Grapevine.

    Tickets for Ice! featuring Harry Potter (starting about $33) are now available at the website.

    holidayskidsfamiliesfairs-festivals
    news/entertainment
    Loading...