• Home
  • popular
  • Events
  • Submit New Event
  • Subscribe
  • About
  • News
  • Restaurants + Bars
  • City Life
  • Entertainment
  • Travel
  • Real Estate
  • Arts
  • Society
  • Home + Design
  • Fashion + Beauty
  • Innovation
  • Sports
  • Charity Guide
  • children
  • education
  • health
  • veterans
  • SOCIAL SERVICES
  • ARTS + CULTURE
  • animals
  • lgbtq
  • New Charity
  • Series
  • Delivery Limited
  • DTX Giveaway 2012
  • DTX Ski Magic
  • dtx woodford reserve manhattans
  • Your Home in the Sky
  • DTX Best of 2013
  • DTX Trailblazers
  • Tastemakers Dallas 2017
  • Healthy Perspectives
  • Neighborhood Eats 2015
  • The Art of Making Whiskey
  • DTX International Film Festival
  • DTX Tatum Brown
  • Tastemaker Awards 2016 Dallas
  • DTX McCurley 2014
  • DTX Cars in Lifestyle
  • DTX Beyond presents Party Perfect
  • DTX Texas Health Resources
  • DART 2018
  • Alexan Central
  • State Fair 2018
  • Formula 1 Giveaway
  • Zatar
  • CityLine
  • Vision Veritas
  • Okay to Say
  • Hearts on the Trinity
  • DFW Auto Show 2015
  • Northpark 50
  • Anteks Curated
  • Red Bull Cliff Diving
  • Maggie Louise Confections Dallas
  • Gaia
  • Red Bull Global Rally Cross
  • NorthPark Holiday 2015
  • Ethan's View Dallas
  • DTX City Centre 2013
  • Galleria Dallas
  • Briggs Freeman Sotheby's International Realty Luxury Homes in Dallas Texas
  • DTX Island Time
  • Simpson Property Group SkyHouse
  • DIFFA
  • Lotus Shop
  • Holiday Pop Up Shop Dallas
  • Clothes Circuit
  • DTX Tastemakers 2014
  • Elite Dental
  • Elan City Lights
  • Dallas Charity Guide
  • DTX Music Scene 2013
  • One Arts Party at the Plaza
  • J.R. Ewing
  • AMLI Design District Vibrant Living
  • Crest at Oak Park
  • Braun Enterprises Dallas
  • NorthPark 2016
  • Victory Park
  • DTX Common Desk
  • DTX Osborne Advisors
  • DTX Comforts of Home 2012
  • DFW Showcase Tour of Homes
  • DTX Neighborhood Eats
  • DTX Comforts of Home 2013
  • DTX Auto Awards
  • Cottonwood Art Festival 2017
  • Nasher Store
  • Guardian of The Glenlivet
  • Zyn22
  • Dallas Rx
  • Yellow Rose Gala
  • Opendoor
  • DTX Sun and Ski
  • Crow Collection
  • DTX Tastes of the Season
  • Skye of Turtle Creek Dallas
  • Cottonwood Art Festival
  • DTX Charity Challenge
  • DTX Culture Motive
  • DTX Good Eats 2012
  • DTX_15Winks
  • St. Bernard Sports
  • Jose
  • DTX SMU 2014
  • DTX Up to Speed
  • st bernard
  • Ardan West Village
  • DTX New York Fashion Week spring 2016
  • Taste the Difference
  • Parktoberfest 2016
  • Bob's Steak and Chop House
  • DTX Smart Luxury
  • DTX Earth Day
  • DTX_Gaylord_Promoted_Series
  • IIDA Lavish
  • Huffhines Art Trails 2017
  • Red Bull Flying Bach Dallas
  • Y+A Real Estate
  • Beauty Basics
  • DTX Pet of the Week
  • Long Cove
  • Charity Challenge 2014
  • Legacy West
  • Wildflower
  • Stillwater Capital
  • Tulum
  • DTX Texas Traveler
  • Dallas DART
  • Soldiers' Angels
  • Alexan Riveredge
  • Ebby Halliday Realtors
  • Zephyr Gin
  • Sixty Five Hundred Scene
  • Christy Berry
  • Entertainment Destination
  • Dallas Art Fair 2015
  • St. Bernard Sports Duck Head
  • Jameson DTX
  • Alara Uptown Dallas
  • Cottonwood Art Festival fall 2017
  • DTX Tastemakers 2015
  • Cottonwood Arts Festival
  • The Taylor
  • Decks in the Park
  • Alexan Henderson
  • Gallery at Turtle Creek
  • Omni Hotel DTX
  • Red on the Runway
  • Whole Foods Dallas 2018
  • Artizone Essential Eats
  • Galleria Dallas Runway Revue
  • State Fair 2016 Promoted
  • Trigger's Toys Ultimate Cocktail Experience
  • Dean's Texas Cuisine
  • Real Weddings Dallas
  • Real Housewives of Dallas
  • Jan Barboglio
  • Wildflower Arts and Music Festival
  • Hearts for Hounds
  • Okay to Say Dallas
  • Indochino Dallas
  • Old Forester Dallas
  • Dallas Apartment Locators
  • Dallas Summer Musicals
  • PSW Real Estate Dallas
  • Paintzen
  • DTX Dave Perry-Miller
  • DTX Reliant
  • Get in the Spirit
  • Bachendorf's
  • Holiday Wonder
  • Village on the Parkway
  • City Lifestyle
  • opportunity knox villa-o restaurant
  • Nasher Summer Sale
  • Simpson Property Group
  • Holiday Gift Guide 2017 Dallas
  • Carlisle & Vine
  • DTX New Beginnings
  • Get in the Game
  • Red Bull Air Race
  • Dallas DanceFest
  • 2015 Dallas Stylemaker
  • Youth With Faces
  • Energy Ogre
  • DTX Renewable You
  • Galleria Dallas Decadence
  • Bella MD
  • Tractorbeam
  • Young Texans Against Cancer
  • Fresh Start Dallas
  • Dallas Farmers Market
  • Soldier's Angels Dallas
  • Shipt
  • Elite Dental
  • Texas Restaurant Association 2017
  • State Fair 2017
  • Scottish Rite
  • Brooklyn Brewery
  • DTX_Stylemakers
  • Alexan Crossings
  • Ascent Victory Park
  • Top Texans Under 30 Dallas
  • Discover Downtown Dallas
  • San Luis Resort Dallas
  • Greystar The Collection
  • FIG Finale
  • Greystar M Line Tower
  • Lincoln Motor Company
  • The Shelby
  • Jonathan Goldwater Events
  • Windrose Tower
  • Gift Guide 2016
  • State Fair of Texas 2016
  • Choctaw Dallas
  • TodayTix Dallas promoted
  • Whole Foods
  • Unbranded 2014
  • Frisco Square
  • Unbranded 2016
  • Circuit of the Americas 2018
  • The Katy
  • Snap Kitchen
  • Partners Card
  • Omni Hotels Dallas
  • Landmark on Lovers
  • Harwood Herd
  • Galveston.com Dallas
  • Holiday Happenings Dallas 2018
  • TenantBase
  • Cottonwood Art Festival 2018
  • Hawkins-Welwood Homes
  • The Inner Circle Dallas
  • Eating in Season Dallas
  • ATTPAC Behind the Curtain
  • TodayTix Dallas
  • The Alexan
  • Toyota Music Factory
  • Nosh Box Eatery
  • Wildflower 2018
  • Society Style Dallas 2018
  • Texas Scottish Rite Hospital 2018
  • 5 Mockingbird
  • 4110 Fairmount
  • Visit Taos
  • Allegro Addison
  • Dallas Tastemakers 2018
  • The Village apartments
  • City of Burleson Dallas

    Weekend Event Planner

    These are the 8 best things to do this weekend in Dallas — including Star Wars

    Alex Bentley
    Dec 17, 2015 | 6:00 am

    With a week to go until Christmas, you'd figure the events slate would still be dominated by holiday events. Not so, as this weekend will bring the return of a hugely popular musical, a massive Lego display, a concert from a great musician, and the opening of possibly the most anticipated movie of all time.

    Below are the best options for your precious free time Thursday through Sunday. Don't like what you see? Lucky for you, we have a much longer list of the city's best events.

    Thursday, December 17

    Star Wars: The Force Awakens at Alamo Drafthouse
    ​There is no shortage of theaters at which to see Star Wars: The Force Awakens, but few will be more fun than the Alamo Drafthouse in Richardson. Virtually the entire cineplex will be given over to the film, as there will be a Star Wars-themed menu, costumed characters, a life-sized replica of the Millennium Falcon cockpit, performances by the Richardson Symphony Orchestra quartet, and much more. Oh, yeah, and after the sold-out screenings on Thursday night, they'll have 22 screenings every day through Sunday.

    AT&T Performing Arts Center presents Jersey Boys
    Since its 2005 debut on Broadway, Jersey Boys has made two different stops in Dallas. It's now back for a third time, telling how Frankie Valli and The Four Seasons went from the wrong side of the tracks to become one of the biggest American pop music sensations of all time. It will play at Winspear Opera House through December 27.

    Galleria Dallas presents Dallas Cityscape
    Even though it's not specifically holiday-themed, the annual Dallas Cityscape exhibit at Galleria Dallas has become one of the mall's holiday traditions. It features replicas of well-known Dallas buildings on a miniature scale, including American Airlines Center, the Old Red Courthouse, the façade of the Winspear Opera House, and a 15’ replica of Galleria Dallas. The exhibit will be on display through January 3.

    Friday, December 18

    The Ten Tenors in concert
    Not to be confused with the Three Tenors, which feature Plácido Domingo, José Carreras, and Luciano Pavarotti, the Ten Tenors is an Australian group known for re-imagining rock songs, Broadway tunes, and more. They'll perform at Verizon Theatre in Grand Prairie in support of their latest album, Our Christmas Wish.

    Saturday, December 19

    Deck the City Hall
    The City of Dallas will celebrate the holiday season with this special event outside of Dallas City Hall. Among the activities will be music, ice skating, train and carriage rides, inflatables, and photos with Santa. You can also partake in the requisite food trucks that will be stationed at the event.

    Trombone Shorty & Orleans Avenue in concert with Galactic
    New Orleans has birthed its fair share of amazing jazz musicians, and Trombone Shorty — aka Troy Andrews — is the latest to carry on that tradition. The now 29-year-old has been impressing since a young age, even releasing an album at the tender age of 16. He and his band, Orleans Avenue, will play at South Side Ballroom with help from opening act Galactic.

    Sunday, December 20

    Trans-Siberian Orchestra presents The Ghosts of Christmas Eve
    For its annual holiday visit to Dallas, the Trans-Siberian Orchestra is featuring the live debut of The Ghosts Of Christmas Eve. Anyone attending one of the two performances at American Airlines Center will also receive a digital download of their newest full-length album, Letters From the Labyrinth.

    Screening of It's a Wonderful Life
    You could wait to catch the commercial-interrupted version of It's a Wonderful Life on TV, or you could take advantage of this rare opportunity to see the holiday classic on the big screen at the Majestic Theatre. Put on by the Texas Theatre and Aviation Mobile Cinema, you can now see the story of George Bailey taking stock of his life the way it was meant to be seen.

    The Trans-Siberian Orchestra will play two shows at American Airlines Center on December 20.

    Trans-Siberian Orchestra
    Trans-Siberian Orchestra/Facebook
    The Trans-Siberian Orchestra will play two shows at American Airlines Center on December 20.
    concertstheaterholidaysevent-plannerkidsfamiliesmovies
    news/entertainment

    most read posts

    Crazy wave of Dallas restaurants and bars have all just opened

    Ambitious Indian restaurant Jashan opens at Plano's Legacy North

    Prominent Dallas businessman and sports mogul Tom Hicks dies at 79

    Mural News

    Netflix House will debut in Dallas with murals from acclaimed artist

    Desiree Gutierrez
    Dec 8, 2025 | 12:51 pm
    ​Jeremy Biggers at Netflix House
    Netflix House
    Jeremy Biggers at Netflix House

    A long-awaited immersive venue is opening in Dallas, and it will debut with local art on its walls: Netflix House, a year-round exhibit revolving around Netflix shows and movies, will open at Galleria Dallas on December 11, with two murals from award-winning Dallas multi-medium artist Jeremy Biggers.

    Netflix House is an immersive dive complete with merchandise store, film house, arcade, and restaurant-bar. When it opens, Dallas will be the second location in the U.S., following Philadelphia, where it debuted in November 2025, also with murals from a local artist.

    A graduate of Booker T. Washington High School for Performing and Visual Arts, Biggers is a renowned artist whose murals can be found spashed on walls across Dallas. Many, such as the Selena portrait on the wall outside Top Ten Records at 306 S. Bishop Ave., have become local landmarks.

    He's a logical choice, having worked with a number of corporations including Nike, Adidas, the Dallas Mavericks, and IBM, for whom he created the "THINK" mural in their Dallas corporate office. His works have also been exhibited nationally, including a 2024 solo exhibition "be safe out there bro" at Band of Vices, a gallery in Los Angeles.

    "Being chosen to be the artist to paint this mural, it would have been a disservice to myself, as well as the art scene in the city, not to try to infuse myself into it," he says.

    \u200bJeremy Biggers at Netflix House Jeremy Biggers at Netflix HouseNetflix House

    Biggers did two murals featuring his interpretation of Netflix figures including the Squid Game Young-hee doll, characters from KPop Demon Hunters and megahit series Stranger Things, plus Pandy and DJ Catnip, the best friends in the interactive series Gabby’s Dollhouse.

    Both murals are intensely colored works that incorporate Biggers' signature motif: a grid of polka dots spread across the image.

    • One is on the exterior of Netflix House, at the parking entrance, a colorful collage of characters, measuring 38 feet x 50 feet — the tallest mural Biggers has tackled. He painted it with aerosol; it took him two months to complete.
    • The other is on the interior, on the mall side entrance of Netflix House, measuring 57 feet x 12 feet — a study in moody blacks and blues, with accents of neon-red that give it a 3D effect.

    “I'm trying to tell the story of Netflix, and the story of where Netflix has been historically, where Netflix is headed in the future, and then also infusing my own narrative and my own language visually into that story,” he says.

    “They could have opened this anywhere, so for Dallas to be one of the very first locations — that’s a testament to us as a market, as consumers of arts and consumers in general," he says.

    Jeremy Biggers at Netflix House Jeremy Biggers at Netflix HouseNetflix House

    galleriesopenings
    news/entertainment
    Loading...