• Home
  • popular
  • Events
  • Submit New Event
  • Subscribe
  • About
  • News
  • Restaurants + Bars
  • City Life
  • Entertainment
  • Travel
  • Real Estate
  • Arts
  • Society
  • Home + Design
  • Fashion + Beauty
  • Innovation
  • Sports
  • Charity Guide
  • children
  • education
  • health
  • veterans
  • SOCIAL SERVICES
  • ARTS + CULTURE
  • animals
  • lgbtq
  • New Charity
  • Series
  • Delivery Limited
  • DTX Giveaway 2012
  • DTX Ski Magic
  • dtx woodford reserve manhattans
  • Your Home in the Sky
  • DTX Best of 2013
  • DTX Trailblazers
  • Tastemakers Dallas 2017
  • Healthy Perspectives
  • Neighborhood Eats 2015
  • The Art of Making Whiskey
  • DTX International Film Festival
  • DTX Tatum Brown
  • Tastemaker Awards 2016 Dallas
  • DTX McCurley 2014
  • DTX Cars in Lifestyle
  • DTX Beyond presents Party Perfect
  • DTX Texas Health Resources
  • DART 2018
  • Alexan Central
  • State Fair 2018
  • Formula 1 Giveaway
  • Zatar
  • CityLine
  • Vision Veritas
  • Okay to Say
  • Hearts on the Trinity
  • DFW Auto Show 2015
  • Northpark 50
  • Anteks Curated
  • Red Bull Cliff Diving
  • Maggie Louise Confections Dallas
  • Gaia
  • Red Bull Global Rally Cross
  • NorthPark Holiday 2015
  • Ethan's View Dallas
  • DTX City Centre 2013
  • Galleria Dallas
  • Briggs Freeman Sotheby's International Realty Luxury Homes in Dallas Texas
  • DTX Island Time
  • Simpson Property Group SkyHouse
  • DIFFA
  • Lotus Shop
  • Holiday Pop Up Shop Dallas
  • Clothes Circuit
  • DTX Tastemakers 2014
  • Elite Dental
  • Elan City Lights
  • Dallas Charity Guide
  • DTX Music Scene 2013
  • One Arts Party at the Plaza
  • J.R. Ewing
  • AMLI Design District Vibrant Living
  • Crest at Oak Park
  • Braun Enterprises Dallas
  • NorthPark 2016
  • Victory Park
  • DTX Common Desk
  • DTX Osborne Advisors
  • DTX Comforts of Home 2012
  • DFW Showcase Tour of Homes
  • DTX Neighborhood Eats
  • DTX Comforts of Home 2013
  • DTX Auto Awards
  • Cottonwood Art Festival 2017
  • Nasher Store
  • Guardian of The Glenlivet
  • Zyn22
  • Dallas Rx
  • Yellow Rose Gala
  • Opendoor
  • DTX Sun and Ski
  • Crow Collection
  • DTX Tastes of the Season
  • Skye of Turtle Creek Dallas
  • Cottonwood Art Festival
  • DTX Charity Challenge
  • DTX Culture Motive
  • DTX Good Eats 2012
  • DTX_15Winks
  • St. Bernard Sports
  • Jose
  • DTX SMU 2014
  • DTX Up to Speed
  • st bernard
  • Ardan West Village
  • DTX New York Fashion Week spring 2016
  • Taste the Difference
  • Parktoberfest 2016
  • Bob's Steak and Chop House
  • DTX Smart Luxury
  • DTX Earth Day
  • DTX_Gaylord_Promoted_Series
  • IIDA Lavish
  • Huffhines Art Trails 2017
  • Red Bull Flying Bach Dallas
  • Y+A Real Estate
  • Beauty Basics
  • DTX Pet of the Week
  • Long Cove
  • Charity Challenge 2014
  • Legacy West
  • Wildflower
  • Stillwater Capital
  • Tulum
  • DTX Texas Traveler
  • Dallas DART
  • Soldiers' Angels
  • Alexan Riveredge
  • Ebby Halliday Realtors
  • Zephyr Gin
  • Sixty Five Hundred Scene
  • Christy Berry
  • Entertainment Destination
  • Dallas Art Fair 2015
  • St. Bernard Sports Duck Head
  • Jameson DTX
  • Alara Uptown Dallas
  • Cottonwood Art Festival fall 2017
  • DTX Tastemakers 2015
  • Cottonwood Arts Festival
  • The Taylor
  • Decks in the Park
  • Alexan Henderson
  • Gallery at Turtle Creek
  • Omni Hotel DTX
  • Red on the Runway
  • Whole Foods Dallas 2018
  • Artizone Essential Eats
  • Galleria Dallas Runway Revue
  • State Fair 2016 Promoted
  • Trigger's Toys Ultimate Cocktail Experience
  • Dean's Texas Cuisine
  • Real Weddings Dallas
  • Real Housewives of Dallas
  • Jan Barboglio
  • Wildflower Arts and Music Festival
  • Hearts for Hounds
  • Okay to Say Dallas
  • Indochino Dallas
  • Old Forester Dallas
  • Dallas Apartment Locators
  • Dallas Summer Musicals
  • PSW Real Estate Dallas
  • Paintzen
  • DTX Dave Perry-Miller
  • DTX Reliant
  • Get in the Spirit
  • Bachendorf's
  • Holiday Wonder
  • Village on the Parkway
  • City Lifestyle
  • opportunity knox villa-o restaurant
  • Nasher Summer Sale
  • Simpson Property Group
  • Holiday Gift Guide 2017 Dallas
  • Carlisle & Vine
  • DTX New Beginnings
  • Get in the Game
  • Red Bull Air Race
  • Dallas DanceFest
  • 2015 Dallas Stylemaker
  • Youth With Faces
  • Energy Ogre
  • DTX Renewable You
  • Galleria Dallas Decadence
  • Bella MD
  • Tractorbeam
  • Young Texans Against Cancer
  • Fresh Start Dallas
  • Dallas Farmers Market
  • Soldier's Angels Dallas
  • Shipt
  • Elite Dental
  • Texas Restaurant Association 2017
  • State Fair 2017
  • Scottish Rite
  • Brooklyn Brewery
  • DTX_Stylemakers
  • Alexan Crossings
  • Ascent Victory Park
  • Top Texans Under 30 Dallas
  • Discover Downtown Dallas
  • San Luis Resort Dallas
  • Greystar The Collection
  • FIG Finale
  • Greystar M Line Tower
  • Lincoln Motor Company
  • The Shelby
  • Jonathan Goldwater Events
  • Windrose Tower
  • Gift Guide 2016
  • State Fair of Texas 2016
  • Choctaw Dallas
  • TodayTix Dallas promoted
  • Whole Foods
  • Unbranded 2014
  • Frisco Square
  • Unbranded 2016
  • Circuit of the Americas 2018
  • The Katy
  • Snap Kitchen
  • Partners Card
  • Omni Hotels Dallas
  • Landmark on Lovers
  • Harwood Herd
  • Galveston.com Dallas
  • Holiday Happenings Dallas 2018
  • TenantBase
  • Cottonwood Art Festival 2018
  • Hawkins-Welwood Homes
  • The Inner Circle Dallas
  • Eating in Season Dallas
  • ATTPAC Behind the Curtain
  • TodayTix Dallas
  • The Alexan
  • Toyota Music Factory
  • Nosh Box Eatery
  • Wildflower 2018
  • Society Style Dallas 2018
  • Texas Scottish Rite Hospital 2018
  • 5 Mockingbird
  • 4110 Fairmount
  • Visit Taos
  • Allegro Addison
  • Dallas Tastemakers 2018
  • The Village apartments
  • City of Burleson Dallas

    Weekend Event Planner

    These are the 9 best things to do in Dallas this Christmas weekend

    Alex Bentley
    Dec 24, 2015 | 6:00 am

    Since it's Christmas weekend, most of the big events will be ones we've already highlighted that are designed to get you in the holiday spirit. We'll give a recap of the best ones to see again or for the first time, as well as a smattering of other new events on the docket.

    Below are the best options for your precious free time Thursday through Sunday. Don't like what you see? Lucky for you, we have a much longer list of the city's best events.

    Thursday, December 24

    Holiday at the Arboretum
    It's one thing to hear "The 12 Days of Christmas" sung throughout the holidays, but it's quite another to see each of the verses brought to life at the 12 Days of Christmas at the Dallas Arboretum. Back for its second year, everything from a partridge in a pear tree to 12 drummers drumming gets its own gazebo, and many feature animated characters, lights, and snow. This year, the Arboretum has added 500,000 lights throughout the garden and a 30-foot-tall tree at the center of property. The exhibit is up through January 3.

    The Trains at NorthPark
    ​There are few Dallas holiday traditions as enduring as The Trains at NorthPark, which is now in its 28th year and 17th at NorthPark Center. Sixteen-hundred feet of track takes trains through landmarks across America, including the Margaret Hunt Hill Bridge and Cotton Bowl in Dallas, Times Square in New York City, and the Golden Gate Bridge in San Francisco. The trains run on time through January 3.

    Dallas Theater Center presents A Christmas Carol
    DTC has now put on Charles Dickens' classic story for over 30 years. This year the company is mixing things up by having Hassan El-Amin play the role of Ebenezer Scrooge and Brierley Resident Acting Company member Christie Vela be the play's first female director. The production will run at Wyly Theatre through December 26.

    Angelika Film Center presents It's a Wonderful Life
    If you missed last week's screening of It's a Wonderful Life at the Majestic Theatre, you can make up for it with a Christmas Eve screening at either the Dallas or Plano locations of Angelika Film Center. A film full of darker-than-you-remember moments and plenty of joy, it's the perfect lead-in to Christmas Day.

    Grand Prairie Parks, Arts & Recreation Department presents Prairie Lights
    Everybody loves to look at Christmas lights, and one of the better displays around is this annual event at Lynn Creek Park in Grand Prairie. Featuring 4 million lights set along two miles of path, it has hundreds of all-new displays in shapes of all kinds lining and arching over the roads. Halfway through the drive, visitors can get out of their cars for a stop at Holiday Village, where they'll find food, gifts, Santa Claus, an all-new indoor laser show, and the Holiday Magic Lighted Walk-Through Forest. The second half of the drive ends with an animated light tunnel. You can experience the fun through January 3.

    Friday, December 25

    There are a few events available on Christmas Day, but if there's ever a day to stay home, this is it. Merry Christmas!

    Saturday, December 26

    Zaxby's Heart of Dallas Bowl: Washington vs. Southern Miss
    Bowl season comes to Dallas in the form of the annual Zaxby's Heart of Dallas Bowl. Two schools that have never played football against each other, the University of Washington Huskies and the University of Southern Mississippi Golden Eagles, will each make their first-ever appearance at the historic Cotton Bowl Stadium.

    Dallas Children’s Theater presents Lone Star Circus' Zingari!
    For its brand new 2015 production, Dallas’s very own Lone Star Circus presents Zingari, a loving tribute to the old gypsy roots of many circus families, replete with a cornucopia of talented acrobats, aerialists, equilibrists, jugglers, clowns and four-legged stars from all over the world. The production will play at Dallas Children's Theater through January 3.

    Rick Ross in concert with Jaio
    Dallas-area fans are some of the first to see Rick Ross live in concert after the December 4 release of his latest album, Black Market. With songs like "The Boss," "Aston Martin Music," "You the Boss," and the new "Sorry," Ross' music is perfect antidote to the sugary sweet holiday tunes. He'll play at the Bomb Factory with support from opening act Jaio.

    Sunday, December 27

    Robert Earl Keen's Merry Christmas from the Fam-O-Lee
    It may technically be after Christmas, but there's still a lot to enjoy with this concert. Robert Earl Keen brings his annual holiday party back to Dallas for one night only at the House of Blues, with help from special guests Doyle & Debbie. R.E.K.'s Merry Christmas from the Fam-O-Lee is a holiday hootenanny like no other.

    Dallas Theater Center's annual version of A Christmas Carol runs at Wyly Theatre through December 26.

    Cast of Dallas Theater Center's A Christmas Carol
    Photo by Karen Almond
    Dallas Theater Center's annual version of A Christmas Carol runs at Wyly Theatre through December 26.
    holidaysevent-plannerkidsfamiliesmoviesconcertstheatersports
    news/entertainment

    Movie Review

    Faces of Death returns with modern twist on cult horror film

    Alex Bentley
    Apr 10, 2026 | 10:30 am
    Dacre Montgomery in Faces of Death
    Photo courtesy of of IFC Films
    Dacre Montgomery in Faces of Death.

    True horror fans will likely be familiar with the 1978 cult film Faces of Death, which purported to be a documentary showing real-life killings in gory detail. It didn’t, of course, but that didn’t stop rumors from continuing to spread for decades. Now, almost 50 years and multiple sequels later, comes a new version of Faces of Death, an actual movie that pays homage to the original in interesting ways.

    Margot (Barbie Ferreira) works at a YouTube-like company called Kino as a content moderator, flagging videos that violate the company’s policies. This means her job often involves seeing some truly despicable things from all manner of depraved people. One day, though, she comes across a video that seems a little too real, and after seeing more similar videos, she starts to believe they’re genuine murders.

    Going against her company NDA, she starts to investigate the videos on her own, which puts her on the radar of Arthur (Dacre Montgomery), who is actually kidnapping people and killing them on camera through methods seen in the original Faces of Death film. It’s not long before Arthur tracks her down, with a plan to make her one of his next victims.

    Written and directed by Daniel Goldhaber (How to Blow Up a Pipeline) and co-written by Isa Mazzei, the film is not so much scary as it is creepy, with the occasional gross-out sequence. The idea of having someone emulate the killings in the cult film is a good idea, and pairing it with the modern-day attention economy - in which content creators go to increasing lengths for clicks - is a clever twist on a concept that other films have done.

    The film as a whole is a commentary on how social media and video sharing sites have often decided to prioritize profits over the well-being of their users. Margot is shown allowing videos involving violence and sexual assault to stay on the site while nixing ones depicting how to use Narcan or demonstrating putting on a condom on a banana. Josh (Jermaine Fowler), Margot’s boss, is even explicit in the company mandate that outrageous videos drive views.

    While Arthur has the makings of a good villain, there are few attempts to make him seem truly diabolical. His kidnappings often seem more spur-of-the-moment than calculated, and even though he has a well thought-out dungeon at home, the house’s location in the suburbs seems to make him vulnerable to easy discovery. Goldhaber and Mazzei leave more than a few unanswered questions along the way that take away from the intensity of the story.

    Ferreira is yet another actor from Euphoria who’s capitalizing on her exposure from that show. She plays Margot’s increasing anxiety well, and when the action ratchets up in the final act, she meets the moment in a satisfying way. Montgomery returns to the vibe he had while playing the evil Billy on Stranger Things, and even though his character doesn’t fully live up to his potential, Montgomery sells his evil for all it’s worth.

    The new Faces of Death may not be what some are expecting given the reputation of the previous films, but it’s a solid horror/thriller that uses the brand as a launching pad into something different. It doesn’t make much of a dent in the scare department, but it does give its violence and gore a degree of relevance in today’s often desensitized world.

    ---

    Faces of Death is now playing in theaters.

    moviesfilm
    news/entertainment
    CULTUREMAP EMAILS ARE AWESOME
    Get Dallas intel delivered daily.
    Loading...